Total number of results for Callorhynchus milii are 3
Download
as Fasta All
| NPID | Sequence | Length | Organism | Family | Name | PMID | Peptide_REF |
|---|---|---|---|---|---|---|---|
| NP02294 |
HSEGTFSSDYSKYLDSRRAKDFVQWLMST
|
29 | Callorhynchus milii | Glucagon | Glucagon | 2690815#Berks B.C., Marshall C.J., Carne A., Galloway S.M., Cutfield J.F.#Isolation and structural characterization of insulin and glucagon from the holocephalan species Callorhynchus milii (elephantfish).# Biochem. J. 263:261-266(1989). | |
| NP02621 |
VPTQRLCGSHLVDALYFVCGERGFFYSPKQI
|
31 | Callorhynchus milii | Insulin | Insulin B chain | 2690815#Berks B.C., Marshall C.J., Carne A., Galloway S.M., Cutfield J.F.#Isolation and structural characterization of insulin and glucagon from the holocephalan species Callorhynchus milii (elephantfish).# Biochem. J. 263:261-266(1989). | |
| NP02622 |
GIVEQCCHNTCSLVNLEGYCN
|
21 | Callorhynchus milii | Insulin | Insulin A chain | 2690815#Berks B.C., Marshall C.J., Carne A., Galloway S.M., Cutfield J.F.#Isolation and structural characterization of insulin and glucagon from the holocephalan species Callorhynchus milii (elephantfish).# Biochem. J. 263:261-266(1989). |